UCHL5 Antikörper (Middle Region)
-
- Target Alle UCHL5 Antikörper anzeigen
- UCHL5 (Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UCHL5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UCHL5 antibody was raised against the middle region of UCHL5
- Aufreinigung
- Affinity purified
- Immunogen
- UCHL5 antibody was raised using the middle region of UCHL5 corresponding to a region with amino acids DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK
- Top Product
- Discover our top product UCHL5 Primärantikörper
-
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) antibody
UCHL5 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) (AA 56-87), (N-Term) antibodyUCHL5 Reaktivität: Human, Maus WB, IHC (fro) Wirt: Kaninchen Polyclonal RB4190 unconjugated
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) (AA 136-164) antibodyUCHL5 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB42329 unconjugated
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) (AA 1-326) antibodyUCHL5 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) (AA 1-328) antibodyUCHL5 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) (AA 2-316) antibodyUCHL5 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) (C-Term) antibodyUCHL5 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Zebrafisch (Danio rerio), Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) (AA 56-87) antibodyUCHL5 Reaktivität: Human, Maus WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) antibodyUCHL5 Reaktivität: Human WB Wirt: Maus Monoclonal 8G6 unconjugated
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) antibodyUCHL5 Reaktivität: Human, Maus, Ratte IF Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UCHL5 Blocking Peptide, catalog no. 33R-1959, is also available for use as a blocking control in assays to test for specificity of this UCHL5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UCHL5 (Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5))
- Andere Bezeichnung
- UCHL5 (UCHL5 Produkte)
- Synonyme
- zgc:85615 antikoerper, wu:fj17f09 antikoerper, uch37 antikoerper, cgi-70 antikoerper, DKFZp459M0513 antikoerper, 5830413B11Rik antikoerper, Uch37 antikoerper, CGI-70 antikoerper, INO80R antikoerper, UCH-L5 antikoerper, UCH37 antikoerper, ubiquitin carboxyl-terminal hydrolase L5 antikoerper, ubiquitin C-terminal hydrolase L5 antikoerper, ubiquitin C-terminal hydrolase L5 L homeolog antikoerper, ubiquitin carboxyl-terminal esterase L5 antikoerper, uchl5 antikoerper, UCHL5 antikoerper, uchl5.L antikoerper, Uchl5 antikoerper
- Hintergrund
- UCHL5 is the deubiquitinating enzyme associated with the proteasome.
- Molekulargewicht
- 37 kDa (MW of target protein)
-
