KLHL32 Antikörper
Kurzübersicht für KLHL32 Antikörper (ABIN631778)
Target
Reaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Aufreinigung
- Affinity purified
-
Immunogen
- KLHL32 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
KLHL32 Blocking Peptide, (ABIN937611), is also available for use as a blocking control in assays to test for specificity of this KLHL32 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL32 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
- Avoid repeated freeze/thaw cycles.
-
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- KLHL32 (Kelch-Like 32 (KLHL32))
-
Andere Bezeichnung
- KLHL32
-
Hintergrund
- The specific function of KLHL32 is not yet known.
-
Molekulargewicht
- 70 kDa (MW of target protein)
Target
-