Lipin 1 Antikörper (N-Term)

Produktnummer ABIN631777

Produktdetails anti-Lipin 1 Antikörper

Target: Lipin 1 (LPIN1)

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Lipin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Lipin 1 antibody was raised against the N terminal of LPIN1

Aufreinigung: Affinity purified

Immunogen: Lipin 1 antibody was raised using the N terminal of LPIN1 corresponding to a region with amino acids SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lipin 1 Blocking Peptide, catalog no. 33R-8579, is also available for use as a blocking control in assays to test for specificity of this Lipin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPIN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Lipin 1

Target: Lipin 1 (LPIN1)

Andere Bezeichnung: Lipin 1 (LPIN1 Produkte)

Synonyme: LPIN1 antikoerper, pap1 antikoerper, PAP1 antikoerper, 4631420P06 antikoerper, Kiaa0188 antikoerper, Lipin1 antikoerper, fld antikoerper, mKIAA0188 antikoerper, zgc:194552 antikoerper, zgc:194558 antikoerper, lipin1 antikoerper, lipin 1 antikoerper, phosphatidate phosphatase LPIN1 antikoerper, LPIN1 antikoerper, lpin1 antikoerper, LOC100539289 antikoerper, Lpin1 antikoerper

Hintergrund: This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism.

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process