Lipin 1 Antikörper (N-Term)

Produktnummer ABIN631777

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Lipin 1 in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für Lipin 1 Antikörper (N-Term) (ABIN631777)

Target: Lipin 1 (LPIN1)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Lipin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Lipin 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Lipin 1 antibody was raised against the N terminal of LPIN1

Aufreinigung: Affinity purified

Immunogen: Lipin 1 antibody was raised using the N terminal of LPIN1 corresponding to a region with amino acids SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lipin 1 Blocking Peptide, (ABIN5614467), is also available for use as a blocking control in assays to test for specificity of this Lipin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPIN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Lipin 1

Target: Lipin 1 (LPIN1)

Andere Bezeichnung: Lipin 1

Hintergrund: This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism.

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process