HB (N-Term) Antikörper

Produktnummer ABIN631771

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HB in WB. Es zeigt Reaktivität gegenüber Proben von Drosophila melanogaster.

Kurzübersicht für HB (N-Term) Antikörper (ABIN631771)

Target: HB

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: HB antibody was raised against the N terminal Of Hb

Aufreinigung: Affinity purified

Immunogen: HB antibody was raised using the N terminal Of Hb corresponding to a region with amino acids MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HB Blocking Peptide, (ABIN5613938), is also available for use as a blocking control in assays to test for specificity of this HB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: HB

Hintergrund: Hb is a gap class segmentation protein that controls development of head structures.

Molekulargewicht: 83 kDa (MW of target protein)