LCA5L Antikörper (N-Term)

Produktnummer ABIN631770

Produktdetails anti-LCA5L Antikörper

Target: LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCA5L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C21 ORF13 antibody was raised against the N terminal Of C21 rf13

Aufreinigung: Affinity purified

Immunogen: C21 ORF13 antibody was raised using the N terminal Of C21 rf13 corresponding to a region with amino acids SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C21ORF13 Blocking Peptide, catalog no. 33R-8574, is also available for use as a blocking control in assays to test for specificity of this C21ORF13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCA5L

Target: LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))

Andere Bezeichnung: C21ORF13 (LCA5L Produkte)

Synonyme: C21orf13 antikoerper, 4921526F01Rik antikoerper, Lcca5l antikoerper, Leber congenital amaurosis 5-like antikoerper, LCA5L, lebercilin like antikoerper, LCA5L antikoerper, Lca5l antikoerper

Hintergrund: The function of the C21orf13 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 76 kDa (MW of target protein)