NAPEPLD Antikörper (N-Term)

Produktnummer ABIN631766

Produktdetails anti-NAPEPLD Antikörper

Target: NAPEPLD (N-Acyl Phosphatidylethanolamine phospholipase D (NAPEPLD))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAPEPLD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NAPE-PLD antibody was raised against the N terminal Of Nape-Pld

Aufreinigung: Affinity purified

Immunogen: NAPE-PLD antibody was raised using the N terminal Of Nape-Pld corresponding to a region with amino acids TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NAPE-PLD Blocking Peptide, catalog no. 33R-9379, is also available for use as a blocking control in assays to test for specificity of this NAPE-PLD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAPE-PLD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAPEPLD

Target: NAPEPLD (N-Acyl Phosphatidylethanolamine phospholipase D (NAPEPLD))

Andere Bezeichnung: NAPE-PLD (NAPEPLD Produkte)

Synonyme: FMP30 antikoerper, NAPE-PLD antikoerper, A530089G06 antikoerper, Mbldc1 antikoerper, N-acyl phosphatidylethanolamine phospholipase D antikoerper, NAPEPLD antikoerper, Napepld antikoerper

Hintergrund: NAPE-PLD hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. NAPE-PLD is responsible for the generation of anandamide (N-arachidonoylethanolamine).

Molekulargewicht: 45 kDa (MW of target protein)