EIF5 Antikörper (N-Term)

Produktnummer ABIN631763

Der Kaninchen Polyklonal Anti-EIF5-Antikörper wurde für WB validiert. Er ist geeignet, EIF5 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für EIF5 Antikörper (N-Term) (ABIN631763)

Target: EIF5 (Eukaryotic Translation Initiation Factor 5 (EIF5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EIF5 Antikörper

Bindungsspezifität: N-Term

Spezifität: EIF5 antibody was raised against the N terminal of EIF5

Aufreinigung: Affinity purified

Immunogen: EIF5 antibody was raised using the N terminal of EIF5 corresponding to a region with amino acids SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF5 Blocking Peptide, (ABIN5613351), is also available for use as a blocking control in assays to test for specificity of this EIF5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF5

Target: EIF5 (Eukaryotic Translation Initiation Factor 5 (EIF5))

Andere Bezeichnung: EIF5

Hintergrund: EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex.

Molekulargewicht: 49 kDa (MW of target protein)