KLRAQ1 Antikörper (N-Term)

Produktnummer ABIN631762

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch KLRAQ1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für KLRAQ1 Antikörper (N-Term) (ABIN631762)

Target: KLRAQ1 (KLRAQ Motif Containing 1 (KLRAQ1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLRAQ1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KLRAQ1 Antikörper

Bindungsspezifität: N-Term

Spezifität: CCDC128 antibody was raised against the N terminal of CCDC128

Aufreinigung: Affinity purified

Immunogen: CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC128 Blocking Peptide, (ABIN940023), is also available for use as a blocking control in assays to test for specificity of this CCDC128 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC128 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLRAQ1

Target: KLRAQ1 (KLRAQ Motif Containing 1 (KLRAQ1))

Andere Bezeichnung: CCDC128

Hintergrund: The function of CCDC128 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 87 kDa (MW of target protein)