VARS Antikörper (Middle Region)

Produktnummer ABIN631756

Produktdetails anti-VARS Antikörper

Target: VARS (Valyl-tRNA Synthetase (VARS))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VARS antibody was raised against the middle region of VARS

Aufreinigung: Affinity purified

Immunogen: VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VARS Blocking Peptide, catalog no. 33R-9521, is also available for use as a blocking control in assays to test for specificity of this VARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VARS

Target: VARS (Valyl-tRNA Synthetase (VARS))

Andere Bezeichnung: VARS (VARS Produkte)

Synonyme: G7A antikoerper, VARS1 antikoerper, VARS2 antikoerper, VARS antikoerper, Bat6 antikoerper, D17H6S56E antikoerper, G7a antikoerper, Vars2 antikoerper, vars1 antikoerper, vars2 antikoerper, CHUNP6879 antikoerper, im:7137378 antikoerper, wu:fb07a11 antikoerper, wu:fb07d10 antikoerper, TrsVal antikoerper, BEST:LD45671 antikoerper, CG4062 antikoerper, Dmel\\CG4062 antikoerper, VRS antikoerper, ValRS antikoerper, l(2)03531 antikoerper, l(2)rI255 antikoerper, ld45671 antikoerper, ECK4251 antikoerper, JW4215 antikoerper, val-act antikoerper, T5E21.11 antikoerper, T5E21_11 antikoerper, TWIN 2 antikoerper, VALRS antikoerper, VALYL TRNA SYNTHETASE antikoerper, valyl-tRNA synthetase antikoerper, Valyl-tRNA synthetase antikoerper, valyl-tRNA synthetase S homeolog antikoerper, hypothetical protein antikoerper, valyl-tRNA synthetase 2, mitochondrial antikoerper, valyl-tRNA synthetase / valine-tRNA ligase (VALRS) antikoerper, VARS antikoerper, Vars antikoerper, vars antikoerper, ValRS antikoerper, vars.S antikoerper, MW0078 antikoerper, Pnap_3169 antikoerper, valS antikoerper, Fnod_0343 antikoerper, Cyan7425_1070 antikoerper, Tola_0553 antikoerper, Slip_0680 antikoerper, Astex_3136 antikoerper, ML5_3395 antikoerper, VARS2 antikoerper, TWN2 antikoerper

Hintergrund: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.

Molekulargewicht: 140 kDa (MW of target protein)