VARS Antikörper (Middle Region)

Produktnummer ABIN631756

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch VARS in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für VARS Antikörper (Middle Region) (ABIN631756)

Target: VARS (Valyl-tRNA Synthetase (VARS))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VARS Antikörper

Bindungsspezifität: Middle Region

Spezifität: VARS antibody was raised against the middle region of VARS

Aufreinigung: Affinity purified

Immunogen: VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VARS Blocking Peptide, (ABIN5616945), is also available for use as a blocking control in assays to test for specificity of this VARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VARS

Target: VARS (Valyl-tRNA Synthetase (VARS))

Andere Bezeichnung: VARS

Hintergrund: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.

Molekulargewicht: 140 kDa (MW of target protein)