VARS Antikörper (Middle Region)
-
- Target Alle VARS Antikörper anzeigen
- VARS (Valyl-tRNA Synthetase (VARS))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VARS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- VARS antibody was raised against the middle region of VARS
- Aufreinigung
- Affinity purified
- Immunogen
- VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML
- Top Product
- Discover our top product VARS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VARS Blocking Peptide, catalog no. 33R-1456, is also available for use as a blocking control in assays to test for specificity of this VARS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VARS (Valyl-tRNA Synthetase (VARS))
- Andere Bezeichnung
- VARS (VARS Produkte)
- Synonyme
- G7A antikoerper, VARS1 antikoerper, VARS2 antikoerper, VARS antikoerper, Bat6 antikoerper, D17H6S56E antikoerper, G7a antikoerper, Vars2 antikoerper, vars1 antikoerper, vars2 antikoerper, CHUNP6879 antikoerper, im:7137378 antikoerper, wu:fb07a11 antikoerper, wu:fb07d10 antikoerper, TrsVal antikoerper, BEST:LD45671 antikoerper, CG4062 antikoerper, Dmel\\CG4062 antikoerper, VRS antikoerper, ValRS antikoerper, l(2)03531 antikoerper, l(2)rI255 antikoerper, ld45671 antikoerper, ECK4251 antikoerper, JW4215 antikoerper, val-act antikoerper, T5E21.11 antikoerper, T5E21_11 antikoerper, TWIN 2 antikoerper, VALRS antikoerper, VALYL TRNA SYNTHETASE antikoerper, valyl-tRNA synthetase antikoerper, Valyl-tRNA synthetase antikoerper, valyl-tRNA synthetase S homeolog antikoerper, hypothetical protein antikoerper, valyl-tRNA synthetase 2, mitochondrial antikoerper, valyl-tRNA synthetase / valine-tRNA ligase (VALRS) antikoerper, VARS antikoerper, Vars antikoerper, vars antikoerper, ValRS antikoerper, vars.S antikoerper, MW0078 antikoerper, Pnap_3169 antikoerper, valS antikoerper, Fnod_0343 antikoerper, Cyan7425_1070 antikoerper, Tola_0553 antikoerper, Slip_0680 antikoerper, Astex_3136 antikoerper, ML5_3395 antikoerper, VARS2 antikoerper, TWN2 antikoerper
- Hintergrund
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.
- Molekulargewicht
- 140 kDa (MW of target protein)
-