ELAC1 Antikörper
-
- Target Alle ELAC1 Antikörper anzeigen
- ELAC1
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ELAC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ELAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLEN
- Top Product
- Discover our top product ELAC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ELAC1 Blocking Peptide, catalog no. 33R-4938, is also available for use as a blocking control in assays to test for specificity of this ELAC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELAC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ELAC1
- Andere Bezeichnung
- ELAC1 (ELAC1 Produkte)
- Synonyme
- ELAC1 antikoerper, zgc:91956 antikoerper, 2610018O07Rik antikoerper, 8430417G19Rik antikoerper, D29 antikoerper, elaC ribonuclease Z 1 antikoerper, elac1 antikoerper, ELAC1 antikoerper, Elac1 antikoerper
- Hintergrund
- ELAC1 belongs to the RNase Z family. It is a zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. The protein is probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.
- Molekulargewicht
- 40 kDa (MW of target protein)
-