Tiparp Antikörper

Produktnummer ABIN631753

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Tiparp in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für Tiparp Antikörper (ABIN631753)

Target: Tiparp (TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tiparp Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Tiparp Antikörper

Aufreinigung: Affinity purified

Immunogen: TIPARP antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TIPARP Blocking Peptide, (ABIN940493), is also available for use as a blocking control in assays to test for specificity of this TIPARP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIPARP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tiparp

Target: Tiparp (TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp))

Andere Bezeichnung: TIPARP

Hintergrund: TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor, repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.

Molekulargewicht: 76 kDa (MW of target protein)

Pathways: Platelet-derived growth Factor Receptor Signaling