Tiparp Antikörper
-
- Target Alle Tiparp Antikörper anzeigen
- Tiparp (TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Tiparp Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TIPARP antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL
- Top Product
- Discover our top product Tiparp Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TIPARP Blocking Peptide, catalog no. 33R-5107, is also available for use as a blocking control in assays to test for specificity of this TIPARP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIPARP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tiparp (TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp))
- Andere Bezeichnung
- TIPARP (Tiparp Produkte)
- Synonyme
- TIPARP antikoerper, fc03g05 antikoerper, sb:cb841 antikoerper, si:dkey-33k14.4 antikoerper, wu:fc03g05 antikoerper, zgc:153056 antikoerper, ddf1 antikoerper, parp7 antikoerper, parp-1 antikoerper, parp-7 antikoerper, ARTD14 antikoerper, PARP7 antikoerper, pART14 antikoerper, AW558171 antikoerper, RM1 antikoerper, TCDD inducible poly(ADP-ribose) polymerase antikoerper, TCDD-inducible poly(ADP-ribose) polymerase antikoerper, TCDD-inducible poly [ADP-ribose] polymerase antikoerper, TIPARP antikoerper, tiparp antikoerper, LOC100018933 antikoerper, Tiparp antikoerper
- Hintergrund
- TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor, repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.
- Molekulargewicht
- 76 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-