IARS Antikörper (N-Term)

Produktnummer ABIN631752

Dieses Anti-IARS-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IARS in WB. Geeignet für Human.

Kurzübersicht für IARS Antikörper (N-Term) (ABIN631752)

Target: IARS (Isoleucyl-tRNA Synthetase (IARS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IARS Antikörper

Bindungsspezifität: N-Term

Spezifität: IARS antibody was raised against the N terminal of IARS

Aufreinigung: Affinity purified

Immunogen: IARS antibody was raised using the N terminal of IARS corresponding to a region with amino acids SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IARS Blocking Peptide, (ABIN5614121), is also available for use as a blocking control in assays to test for specificity of this IARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IARS

Target: IARS (Isoleucyl-tRNA Synthetase (IARS))

Andere Bezeichnung: IARS

Hintergrund: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS.

Molekulargewicht: 144 kDa (MW of target protein)