ELP2 Antikörper

Produktnummer ABIN631751

Produktdetails anti-ELP2 Antikörper

Target: ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ELP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ELP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ELP2 Blocking Peptide, catalog no. 33R-2389, is also available for use as a blocking control in assays to test for specificity of this ELP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ELP2

Target: ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))

Andere Bezeichnung: ELP2 (ELP2 Produkte)

Synonyme: zgc:153559 antikoerper, SHINC-2 antikoerper, STATIP1 antikoerper, StIP antikoerper, AU023723 antikoerper, Epl2 antikoerper, StIP1 antikoerper, Statip1 antikoerper, F14J22.24 antikoerper, elongator protein 2 antikoerper, elongator acetyltransferase complex subunit 2 antikoerper, elongator protein 2 antikoerper, elp2 antikoerper, ELP2 antikoerper, Elp2 antikoerper

Hintergrund: ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.

Molekulargewicht: 92 kDa (MW of target protein)

Pathways: Stem Cell Maintenance, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus