GPN2 Antikörper (Middle Region)

Produktnummer ABIN631748

Produktdetails anti-GPN2 Antikörper

Target: GPN2 (GPN-Loop GTPase 2 (GPN2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GPN2 antibody was raised against the middle region of GPN2

Aufreinigung: Affinity purified

Immunogen: GPN2 antibody was raised using the middle region of GPN2 corresponding to a region with amino acids VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPN2 Blocking Peptide, catalog no. 33R-9680, is also available for use as a blocking control in assays to test for specificity of this GPN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPN2

Target: GPN2 (GPN-Loop GTPase 2 (GPN2))

Andere Bezeichnung: GPN2 (GPN2 Produkte)

Synonyme: ATPBD1B antikoerper, Atpbd1b antikoerper, RGD1311749 antikoerper, atpbd1b antikoerper, zgc:92877 antikoerper, AI838661 antikoerper, R74630 antikoerper, RP23-137L22.10 antikoerper, GPN-loop GTPase 2 antikoerper, GPN-loop GTPase 2 S homeolog antikoerper, G-patch domain containing 3 antikoerper, GPN2 antikoerper, Gpn2 antikoerper, gpn2.S antikoerper, gpn2 antikoerper, GPATCH3 antikoerper

Hintergrund: The function of GPN protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 34 kDa (MW of target protein)