SAE1 Antikörper (N-Term)
-
- Target Alle SAE1 Antikörper anzeigen
- SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SAE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SAE1 antibody was raised against the N terminal of SAE1
- Aufreinigung
- Affinity purified
- Immunogen
- SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE
- Top Product
- Discover our top product SAE1 Primärantikörper
-
anti-SUMO1 Activating Enzyme Subunit 1 (SAE1) antibody
KO Validated SAE1 Reaktivität: Human WB, IF, IHC (p), ICC, IP Wirt: Kaninchen Polyclonal unconjugated
anti-SUMO1 Activating Enzyme Subunit 1 (SAE1) (AA 1-346) antibodySAE1 Reaktivität: Human WB, ELISA, IF, IHC (p) Wirt: Maus Monoclonal 1G4-1G5 unconjugated
anti-SUMO1 Activating Enzyme Subunit 1 (SAE1) (AA 300-329), (C-Term) antibodySAE1 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB2887-RB2888 unconjugated
anti-SUMO1 Activating Enzyme Subunit 1 (SAE1) (Internal Region) antibodySAE1 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-SUMO1 Activating Enzyme Subunit 1 (SAE1) (AA 1-346) antibodySAE1 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-SUMO1 Activating Enzyme Subunit 1 (SAE1) (AA 1-346) antibodySAE1 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-SUMO1 Activating Enzyme Subunit 1 (SAE1) antibodySAE1 Reaktivität: Human WB, ELISA, IF Wirt: Kaninchen Monoclonal 9D8 unconjugated Recombinant Antibody
anti-SUMO1 Activating Enzyme Subunit 1 (SAE1) antibodySAE1 Reaktivität: Human WB Wirt: Kaninchen Monoclonal unconjugated
anti-SUMO1 Activating Enzyme Subunit 1 (SAE1) antibodySAE1 Reaktivität: Human WB, IHC, IF, IHC (p) Wirt: Maus Monoclonal 1G8 unconjugated
anti-SUMO1 Activating Enzyme Subunit 1 (SAE1) (Center) antibodySAE1 Reaktivität: Human, Affe WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SAE1 Blocking Peptide, catalog no. 33R-6581, is also available for use as a blocking control in assays to test for specificity of this SAE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))
- Andere Bezeichnung
- SAE1 (SAE1 Produkte)
- Synonyme
- AOS1 antikoerper, HSPC140 antikoerper, SUA1 antikoerper, UBLE1A antikoerper, 2400010M20Rik antikoerper, 2610044L12Rik antikoerper, AL033372 antikoerper, AW743391 antikoerper, D7Ertd177e antikoerper, Sua1 antikoerper, Uble1a antikoerper, Aos1p antikoerper, Sua1p antikoerper, aos antikoerper, sae2a antikoerper, uble1a antikoerper, wu:fa28b04 antikoerper, zgc:86633 antikoerper, SUMO1 activating enzyme subunit 1 antikoerper, SUMO1 activating enzyme subunit 1 L homeolog antikoerper, SAE1 antikoerper, Sae1 antikoerper, sae1.L antikoerper, sae1 antikoerper
- Hintergrund
- Posttranslational modification of proteins by the addition of the small protein SUMO, or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins.
- Molekulargewicht
- 38 kDa (MW of target protein)
-
