SAE1 Antikörper (N-Term)

Produktnummer ABIN631747

Produktdetails anti-SAE1 Antikörper

Target: SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SAE1 antibody was raised against the N terminal of SAE1

Aufreinigung: Affinity purified

Immunogen: SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAE1 Blocking Peptide, catalog no. 33R-6581, is also available for use as a blocking control in assays to test for specificity of this SAE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAE1

Target: SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))

Andere Bezeichnung: SAE1 (SAE1 Produkte)

Hintergrund: Posttranslational modification of proteins by the addition of the small protein SUMO, or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins.

Molekulargewicht: 38 kDa (MW of target protein)