IARS Antikörper (Middle Region)
-
- Target Alle IARS Antikörper anzeigen
- IARS (Isoleucyl-tRNA Synthetase (IARS))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IARS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IARS antibody was raised against the middle region of IARS
- Aufreinigung
- Affinity purified
- Immunogen
- IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD
- Top Product
- Discover our top product IARS Primärantikörper
-
anti-Isoleucyl-tRNA Synthetase (IARS) (AA 1172-1262) antibody
IARS Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3D3 unconjugated
anti-Isoleucyl-tRNA Synthetase (IARS) (AA 1-1055) antibodyIARS Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Isoleucyl-tRNA Synthetase (IARS) (AA 1-1055) antibodyIARS Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Isoleucyl-tRNA Synthetase (IARS) (AA 1-500) antibodyIARS Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Isoleucyl-tRNA Synthetase (IARS) (AA 1158-1262) antibodyIARS Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Isoleucyl-tRNA Synthetase (IARS) (C-Term) antibodyIARS Reaktivität: Human, Maus, Ratte WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Isoleucyl-tRNA Synthetase (IARS) (AA 35-84) antibodyIARS Reaktivität: Human, Maus, Ratte, Hund, Pferd, Schwein, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Isoleucyl-tRNA Synthetase (IARS) (N-Term) antibodyIARS Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IARS Blocking Peptide, catalog no. 33R-10078, is also available for use as a blocking control in assays to test for specificity of this IARS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IARS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IARS (Isoleucyl-tRNA Synthetase (IARS))
- Andere Bezeichnung
- IARS (IARS Produkte)
- Hintergrund
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs.
- Molekulargewicht
- 144 kDa (MW of target protein)
-
