UPP1 Antikörper (N-Term)

Produktnummer ABIN631743

Dieses Anti-UPP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von UPP1 in WB. Geeignet für Human.

Kurzübersicht für UPP1 Antikörper (N-Term) (ABIN631743)

Target: UPP1 (Uridine Phosphorylase 1 (UPP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UPP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UPP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: UPP1 antibody was raised against the N terminal of UPP1

Aufreinigung: Affinity purified

Immunogen: UPP1 antibody was raised using the N terminal of UPP1 corresponding to a region with amino acids AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UPP1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this UPP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UPP1

Target: UPP1 (Uridine Phosphorylase 1 (UPP1))

Andere Bezeichnung: UPP1

Hintergrund: UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process