RCC2 Antikörper (Middle Region)

Produktnummer ABIN631742

Der Kaninchen Polyklonal Anti-RCC2-Antikörper wurde für WB validiert. Er ist geeignet, RCC2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für RCC2 Antikörper (Middle Region) (ABIN631742)

Target: RCC2 (Regulator of Chromosome Condensation 2 (RCC2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RCC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RCC2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RCC2 antibody was raised against the middle region of RCC2

Aufreinigung: Affinity purified

Immunogen: RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RCC2 Blocking Peptide, (ABIN5615814), is also available for use as a blocking control in assays to test for specificity of this RCC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RCC2

Target: RCC2 (Regulator of Chromosome Condensation 2 (RCC2))

Andere Bezeichnung: RCC2

Hintergrund: RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Molekulargewicht: 56 kDa (MW of target protein)