TRAPPC6B Antikörper (Middle Region)

Produktnummer ABIN631728

Produktdetails anti-TRAPPC6B Antikörper

Target: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAPPC6B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRAPPC6 B antibody was raised against the middle region of TRAPPC6

Aufreinigung: Affinity purified

Immunogen: TRAPPC6 B antibody was raised using the middle region of TRAPPC6 corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAPPC6B Blocking Peptide, catalog no. 33R-9336, is also available for use as a blocking control in assays to test for specificity of this TRAPPC6B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAPPC6B

Target: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Andere Bezeichnung: TRAPPC6B (TRAPPC6B Produkte)

Synonyme: zgc:103464 antikoerper, TPC6 antikoerper, 5830498C14Rik antikoerper, C79212 antikoerper, RGD1309325 antikoerper, trafficking protein particle complex 6b antikoerper, Trafficking protein particle complex subunit 6B antikoerper, trafficking protein particle complex subunit 6B antikoerper, trafficking protein particle complex subunit 6b antikoerper, trafficking protein particle complex 6B antikoerper, trafficking protein particle complex 6B L homeolog antikoerper, LOC733029 antikoerper, cgd3_2700 antikoerper, NCU06212 antikoerper, ATEG_05652 antikoerper, LOC5563708 antikoerper, CC1G_04333 antikoerper, CpipJ_CPIJ005932 antikoerper, PTRG_01279 antikoerper, TTHERM_00657360 antikoerper, PITG_00953 antikoerper, Tsp_08307 antikoerper, trappc6b antikoerper, trappc6b.L antikoerper, TRAPPC6B antikoerper, Trappc6b antikoerper

Hintergrund: TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport.

Molekulargewicht: 15 kDa (MW of target protein)