TRAPPC6B Antikörper (Middle Region)

Produktnummer ABIN631728

Dieser Anti-TRAPPC6B-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von TRAPPC6B in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für TRAPPC6B Antikörper (Middle Region) (ABIN631728)

Target: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAPPC6B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRAPPC6B Antikörper

Bindungsspezifität: Middle Region

Spezifität: TRAPPC6 B antibody was raised against the middle region of TRAPPC6

Aufreinigung: Affinity purified

Immunogen: TRAPPC6 B antibody was raised using the middle region of TRAPPC6 corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAPPC6B Blocking Peptide, (ABIN5616768), is also available for use as a blocking control in assays to test for specificity of this TRAPPC6B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAPPC6B

Target: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Andere Bezeichnung: TRAPPC6B

Hintergrund: TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport.

Molekulargewicht: 15 kDa (MW of target protein)