FBXO28 Antikörper (Middle Region)
-
- Target Alle FBXO28 Antikörper anzeigen
- FBXO28 (F-Box Protein 28 (FBXO28))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXO28 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXO28 antibody was raised against the middle region of FBXO28
- Aufreinigung
- Affinity purified
- Immunogen
- FBXO28 antibody was raised using the middle region of FBXO28 corresponding to a region with amino acids ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
- Top Product
- Discover our top product FBXO28 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXO28 Blocking Peptide, catalog no. 33R-2539, is also available for use as a blocking control in assays to test for specificity of this FBXO28 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO28 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO28 (F-Box Protein 28 (FBXO28))
- Andere Bezeichnung
- FBXO28 (FBXO28 Produkte)
- Synonyme
- fd49h06 antikoerper, wu:fd49h06 antikoerper, FBXO28 antikoerper, CENP-30 antikoerper, Fbx28 antikoerper, 4833428J17Rik antikoerper, 5730505P19Rik antikoerper, D1Ertd578e antikoerper, mKIAA0483 antikoerper, F-box protein 28 antikoerper, F-box protein 28 L homeolog antikoerper, fbxo28 antikoerper, fbxo28.L antikoerper, FBXO28 antikoerper, Fbxo28 antikoerper
- Hintergrund
- Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
- Molekulargewicht
- 41 kDa (MW of target protein)
-