FBXO27 Antikörper (Middle Region)

Produktnummer ABIN631723

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FBXO27 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für FBXO27 Antikörper (Middle Region) (ABIN631723)

Target: FBXO27 (F-Box Protein 27 (FBXO27))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO27 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FBXO27 Antikörper

Bindungsspezifität: Middle Region

Spezifität: FBXO27 antibody was raised against the middle region of FBXO27

Aufreinigung: Affinity purified

Immunogen: FBXO27 antibody was raised using the middle region of FBXO27 corresponding to a region with amino acids LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO27 Blocking Peptide, (ABIN940237), is also available for use as a blocking control in assays to test for specificity of this FBXO27 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO27 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO27

Target: FBXO27 (F-Box Protein 27 (FBXO27))

Andere Bezeichnung: FBXO27

Hintergrund: Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molekulargewicht: 31 kDa (MW of target protein)