FLJ25791 (Middle Region) Antikörper

Produktnummer ABIN631722

Der Kaninchen Polyklonal anti-FLJ25791 Antikörper (ABIN631722) detektiert spezifisch FLJ25791 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für FLJ25791 (Middle Region) Antikörper (ABIN631722)

Target: FLJ25791

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: Middle Region

Spezifität: FLJ25791 antibody was raised against the middle region of Flj25791

Aufreinigung: Affinity purified

Immunogen: FLJ25791 antibody was raised using the middle region of Flj25791 corresponding to a region with amino acids EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ25791 Blocking Peptide, (ABIN938217), is also available for use as a blocking control in assays to test for specificity of this FLJ25791 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ25791 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: FLJ25791

Hintergrund: FLJ25791 is believed to be involved in nucleotide kinase activity and nucleotide binding

Molekulargewicht: 36 kDa (MW of target protein)