Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

TPRN Antikörper (Taperin) (Middle Region) Primary Antibody

TPRN Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN631720
$647.32
Zzgl. Versandkosten $45.00
50 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 9 bis 11 Werktagen
  • Target
    TPRN
    Bindungsspezifität
    Middle Region
    • 1
    • 1
    • 1
    Reaktivität
    Human, Maus, Ratte
    • 18
    • 18
    • 18
    • 3
    • 2
    • 2
    • 2
    • 1
    Wirt
    Kaninchen
    • 18
    Klonalität
    Polyklonal
    • 18
    Konjugat
    Dieser TPRN Antikörper ist unkonjugiert
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Applikation
    Western Blotting (WB)
    • 13
    • 6
    • 3
    Spezifität
    C9 ORF75 antibody was raised against the middle region of C9 rf75
    Aufreinigung
    Affinity purified
    Immunogen
    C9 ORF75 antibody was raised using the middle region of C9 rf75 corresponding to a region with amino acids EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    C9ORF75 Blocking Peptide, catalog no. 33R-2269, is also available for use as a blocking control in assays to test for specificity of this C9ORF75 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    TPRN
    Andere Bezeichnung
    C9ORF75 (TPRN Antibody Abstract)
    Synonyme
    C9orf75, DFNB79, RP11-350O14.7, C430004E15Rik, C87750, RP23-132N23.15, taperin, TPRN, Tprn
    Hintergrund
    The specific function of C9orf75 is not yet known.
    Molekulargewicht
    47 kDa (MW of target protein)
    Pathways
    Sensory Perception of Sound
Sie sind hier:
help Kundenservice