TPRN Antikörper (Middle Region)

Produktnummer ABIN631720

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TPRN in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für TPRN Antikörper (Middle Region) (ABIN631720)

Target: TPRN (Taperin (TPRN))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPRN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TPRN Antikörper

Bindungsspezifität: Middle Region

Spezifität: C9 ORF75 antibody was raised against the middle region of C9 rf75

Aufreinigung: Affinity purified

Immunogen: C9 ORF75 antibody was raised using the middle region of C9 rf75 corresponding to a region with amino acids EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C9ORF75 Blocking Peptide, (ABIN937655), is also available for use as a blocking control in assays to test for specificity of this C9ORF75 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPRN

Target: TPRN (Taperin (TPRN))

Andere Bezeichnung: C9ORF75

Hintergrund: The specific function of C9orf75 is not yet known.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Sensory Perception of Sound