-
- Target Alle GPD1 Antikörper anzeigen
- GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
- Top Product
- Discover our top product GPD1 Primärantikörper
-
anti-Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) (AA 1-349) antibody
GPD1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3C10-1C4 unconjugated
anti-Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) (AA 1-349) antibodyGPD1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) (AA 28-57), (N-Term) antibodyGPD1 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB21027 unconjugated
anti-Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) (AA 1-349) antibodyGPD1 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) antibodyGPD1 Reaktivität: Human, Maus WB, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) (AA 35-65), (N-Term) antibodyGPD1 Reaktivität: Human, Maus WB, FACS, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) (AA 1-349) antibodyGPD1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) (AA 110-159) antibodyGPD1 Reaktivität: Human, Maus, Hund, Meerschweinchen, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) (AA 251-300) antibodyGPD1 Reaktivität: Human, Zebrafisch (Danio rerio), Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1) (N-Term) antibodyGPD1 Reaktivität: Human, Maus, Kaninchen, Ratte, Hund, Meerschweinchen, Pferd, Rind (Kuh), Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPD1 Blocking Peptide, catalog no. 33R-9068, is also available for use as a blocking control in assays to test for specificity of this GPD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))
- Andere Bezeichnung
- GPD1 (GPD1 Produkte)
- Hintergrund
- GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).
- Molekulargewicht
- 37 kDa (MW of target protein)
-
Sie sind hier:
