GPD1 Antikörper

Produktnummer ABIN631716

Dieser Anti-GPD1 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von GPD1 in WB. Geeignet für Human.

Kurzübersicht für GPD1 Antikörper (ABIN631716)

Target: GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GPD1 Antikörper

Aufreinigung: Affinity purified

Immunogen: GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPD1 Blocking Peptide, (ABIN5613829), is also available for use as a blocking control in assays to test for specificity of this GPD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPD1

Target: GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))

Andere Bezeichnung: GPD1

Hintergrund: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Molekulargewicht: 37 kDa (MW of target protein)