BPNT1 Antikörper

Produktnummer ABIN631707

Produktdetails anti-BPNT1 Antikörper

Target: BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BPNT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: BPNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BPNT1 Blocking Peptide, catalog no. 33R-2153, is also available for use as a blocking control in assays to test for specificity of this BPNT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPNT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BPNT1

Target: BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1))

Andere Bezeichnung: BPNT1 (BPNT1 Produkte)

Synonyme: BPNT1 antikoerper, PIP antikoerper, Sal3 antikoerper, BPntase antikoerper, 3'(2'), 5'-bisphosphate nucleotidase 1 antikoerper, bisphosphate 3'-nucleotidase 1 antikoerper, BPNT1 antikoerper, bpnt1.L antikoerper, Bpnt1 antikoerper

Hintergrund: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Inositol Metabolic Process