GPD1L Antikörper (Middle Region)
-
- Target Alle GPD1L Antikörper anzeigen
- GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPD1L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GPD1 L antibody was raised against the middle region of GPD1
- Aufreinigung
- Affinity purified
- Immunogen
- GPD1 L antibody was raised using the middle region of GPD1 corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV
- Top Product
- Discover our top product GPD1L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPD1L Blocking Peptide, catalog no. 33R-2538, is also available for use as a blocking control in assays to test for specificity of this GPD1L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))
- Andere Bezeichnung
- GPD1L (GPD1L Produkte)
- Synonyme
- wu:fi13g03 antikoerper, wu:fi45b08 antikoerper, zgc:92580 antikoerper, GPD1-L antikoerper, 2210409H23Rik antikoerper, D9Ertd660e antikoerper, RGD1560123 antikoerper, glycerol-3-phosphate dehydrogenase 1 like antikoerper, glycerol-3-phosphate dehydrogenase 1-like antikoerper, glycerol-3-phosphate dehydrogenase 1 like L homeolog antikoerper, gpd1l antikoerper, GPD1L antikoerper, gpd1l.L antikoerper, Gpd1l antikoerper
- Hintergrund
- GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).
- Molekulargewicht
- 38 kDa (MW of target protein)
-