GPD1L Antikörper (Middle Region)

Produktnummer ABIN631705

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GPD1L in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für GPD1L Antikörper (Middle Region) (ABIN631705)

Target: GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPD1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GPD1L Antikörper

Bindungsspezifität: Middle Region

Spezifität: GPD1 L antibody was raised against the middle region of GPD1

Aufreinigung: Affinity purified

Immunogen: GPD1 L antibody was raised using the middle region of GPD1 corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPD1L Blocking Peptide, (ABIN937924), is also available for use as a blocking control in assays to test for specificity of this GPD1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPD1L

Target: GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))

Andere Bezeichnung: GPD1L

Hintergrund: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Molekulargewicht: 38 kDa (MW of target protein)