GPD1L Antikörper (Middle Region)

Produktnummer ABIN631705

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch GPD1L in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für GPD1L Antikörper (Middle Region) (ABIN631705)

Target: GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPD1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GPD1L Antikörper

Bindungsspezifität: Middle Region

Spezifität: GPD1 L antibody was raised against the middle region of GPD1

Aufreinigung: Affinity purified

Immunogen: GPD1 L antibody was raised using the middle region of GPD1 corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPD1L Blocking Peptide, (ABIN937924), is also available for use as a blocking control in assays to test for specificity of this GPD1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPD1L

Target: GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))

Andere Bezeichnung: GPD1L

Hintergrund: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Molekulargewicht: 38 kDa (MW of target protein)