GNA12 Antikörper

Produktnummer ABIN631704

Der Kaninchen Polyklonal anti-GNA12 Antikörper (ABIN631704) detektiert spezifisch GNA12 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für GNA12 Antikörper (ABIN631704)

Target: GNA12 (Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNA12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GNA12 Antikörper

Aufreinigung: Affinity purified

Immunogen: GNA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNA12 Blocking Peptide, (ABIN5613804), is also available for use as a blocking control in assays to test for specificity of this GNA12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNA12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNA12

Target: GNA12 (Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12))

Andere Bezeichnung: GNA12

Hintergrund: GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Molekulargewicht: 44 kDa (MW of target protein)