GNA12 Antikörper
-
- Target Alle GNA12 Antikörper anzeigen
- GNA12 (Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNA12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GNA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF
- Top Product
- Discover our top product GNA12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GNA12 Blocking Peptide, catalog no. 33R-9073, is also available for use as a blocking control in assays to test for specificity of this GNA12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNA12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNA12 (Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12))
- Andere Bezeichnung
- GNA12 (GNA12 Produkte)
- Synonyme
- NNX3 antikoerper, RMP antikoerper, gep antikoerper, gna12 antikoerper, gna12l antikoerper, AI414047 antikoerper, AI504261 antikoerper, Galpha12 antikoerper, G protein subunit alpha 12 antikoerper, guanine nucleotide binding protein (G protein) alpha 12a antikoerper, guanine nucleotide binding protein, alpha 12 antikoerper, GNA12 antikoerper, Gna12 antikoerper, gna12a antikoerper
- Hintergrund
- GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
- Molekulargewicht
- 44 kDa (MW of target protein)
-