SENP1 Antikörper (Middle Region)

Produktnummer ABIN631695

Dieses Anti-SENP1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SENP1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für SENP1 Antikörper (Middle Region) (ABIN631695)

Target: SENP1 (SUMO1/sentrin Specific Peptidase 1 (SENP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SENP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SENP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SENP1 antibody was raised against the middle region of SENP1

Aufreinigung: Affinity purified

Immunogen: SENP1 antibody was raised using the middle region of SENP1 corresponding to a region with amino acids PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SENP1 Blocking Peptide, (ABIN5616041), is also available for use as a blocking control in assays to test for specificity of this SENP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SENP1

Target: SENP1 (SUMO1/sentrin Specific Peptidase 1 (SENP1))

Andere Bezeichnung: SENP1

Hintergrund: The covalent modification of proteins by the small ubiquitin-like protein SUMO is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1.

Molekulargewicht: 73 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity