PITPNB Antikörper (Middle Region)
-
- Target Alle PITPNB Antikörper anzeigen
- PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PITPNB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PITPNB antibody was raised against the middle region of PITPNB
- Aufreinigung
- Affinity purified
- Immunogen
- PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY
- Top Product
- Discover our top product PITPNB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PITPNB Blocking Peptide, catalog no. 33R-1104, is also available for use as a blocking control in assays to test for specificity of this PITPNB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PITPNB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))
- Andere Bezeichnung
- PITPNB (PITPNB Produkte)
- Synonyme
- VIB1B antikoerper, MGC75853 antikoerper, PtdInsTP antikoerper, PI-TP-beta antikoerper, pitpn antikoerper, AI256223 antikoerper, AU040890 antikoerper, zgc:56092 antikoerper, phosphatidylinositol transfer protein, beta antikoerper, phosphatidylinositol transfer protein, beta L homeolog antikoerper, phosphatidylinositol transfer protein beta antikoerper, pitpnb antikoerper, pitpnb.L antikoerper, PITPNB antikoerper, Pitpnb antikoerper
- Hintergrund
- PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.
- Molekulargewicht
- 31 kDa (MW of target protein)
-