PITPNB Antikörper (Middle Region)

Produktnummer ABIN631693

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PITPNB in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für PITPNB Antikörper (Middle Region) (ABIN631693)

Target: PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PITPNB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PITPNB Antikörper

Bindungsspezifität: Middle Region

Spezifität: PITPNB antibody was raised against the middle region of PITPNB

Aufreinigung: Affinity purified

Immunogen: PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PITPNB Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this PITPNB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PITPNB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PITPNB

Target: PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))

Andere Bezeichnung: PITPNB

Hintergrund: PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.

Molekulargewicht: 31 kDa (MW of target protein)