TTC9C Antikörper (N-Term)

Produktnummer ABIN631689

Produktdetails anti-TTC9C Antikörper

Target: TTC9C (Tetratricopeptide Repeat Domain 9C (TTC9C))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TTC9C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TTC9 C antibody was raised against the N terminal of TTC9

Aufreinigung: Affinity purified

Immunogen: TTC9 C antibody was raised using the N terminal of TTC9 corresponding to a region with amino acids MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TTC9C Blocking Peptide, catalog no. 33R-5931, is also available for use as a blocking control in assays to test for specificity of this TTC9C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TTC9C

Target: TTC9C (Tetratricopeptide Repeat Domain 9C (TTC9C))

Andere Bezeichnung: TTC9C (TTC9C Produkte)

Synonyme: MGC56497 antikoerper, zgc:56497 antikoerper, im:7142077 antikoerper, 2210019E14Rik antikoerper, 6330408J23Rik antikoerper, RGD1359253 antikoerper, tetratricopeptide repeat domain 9C antikoerper, ttc9c antikoerper, TTC9C antikoerper, Ttc9c antikoerper

Hintergrund: The function of TTC9C protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 20 kDa (MW of target protein)