NT5DC1 Antikörper (N-Term)

Produktnummer ABIN631687

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch NT5DC1 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für NT5DC1 Antikörper (N-Term) (ABIN631687)

Target: NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NT5DC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NT5DC1 Antikörper

Bindungsspezifität: N-Term

Spezifität: NT5 DC1 antibody was raised against the N terminal of NT5 C1

Aufreinigung: Affinity purified

Immunogen: NT5 DC1 antibody was raised using the N terminal of NT5 C1 corresponding to a region with amino acids EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NT5DC1 Blocking Peptide, (ABIN938197), is also available for use as a blocking control in assays to test for specificity of this NT5DC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NT5DC1

Target: NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))

Andere Bezeichnung: NT5DC1

Hintergrund: While the exact function of the protein encoded by this gene is not known, it belongs to the 5'(3')-deoxyribonucleotidase family.

Molekulargewicht: 52 kDa (MW of target protein)