ERI2 Antikörper (Middle Region)

Produktnummer ABIN631686

Dieses Anti-ERI2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ERI2 in WB. Geeignet für Human und Maus.

Kurzübersicht für ERI2 Antikörper (Middle Region) (ABIN631686)

Target: ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERI2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ERI2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ERI2 antibody was raised against the middle region of ERI2

Aufreinigung: Affinity purified

Immunogen: ERI2 antibody was raised using the middle region of ERI2 corresponding to a region with amino acids LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERI2 Blocking Peptide, (ABIN5613396), is also available for use as a blocking control in assays to test for specificity of this ERI2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERI2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERI2

Target: ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))

Andere Bezeichnung: ERI2

Hintergrund: EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.

Molekulargewicht: 37 kDa (MW of target protein)