HAO1 Antikörper

Produktnummer ABIN631675

Produktdetails anti-HAO1 Antikörper

Target: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAO1 Blocking Peptide, catalog no. 33R-3411, is also available for use as a blocking control in assays to test for specificity of this HAO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAO1

Target: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Andere Bezeichnung: HAO1 (HAO1 Produkte)

Synonyme: hao1 antikoerper, GOX antikoerper, GOX1 antikoerper, HAOX1 antikoerper, Gox1 antikoerper, XDH1 antikoerper, Hao-1 antikoerper, hydroxyacid oxidase 1 antikoerper, hydroxyacid oxidase (glycolate oxidase) 1 antikoerper, hydroxyacid oxidase (glycolate oxidase) 1 L homeolog antikoerper, hydroxyacid oxidase 1, liver antikoerper, CpipJ_CPIJ013711 antikoerper, THEYE_A0075 antikoerper, hao1 antikoerper, HAO1 antikoerper, hao1.L antikoerper, Hao1 antikoerper

Hintergrund: Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process