HAO1 Antikörper

Produktnummer ABIN631675

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HAO1 in WB. Es zeigt Reaktivität gegenüber Proben von Maus, Human, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für HAO1 Antikörper (ABIN631675)

Target: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Reaktivität: Maus, Human, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HAO1 Antikörper

Aufreinigung: Affinity purified

Immunogen: HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAO1 Blocking Peptide, (ABIN938797), is also available for use as a blocking control in assays to test for specificity of this HAO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAO1

Target: HAO1 (Hydroxyacid Oxidase (Glycolate Oxidase) 1 (HAO1))

Andere Bezeichnung: HAO1

Hintergrund: Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process