Clavesin 1 Antikörper (N-Term)

Produktnummer ABIN631673

Der Kaninchen Polyklonal Anti-Clavesin 1-Antikörper wurde für WB validiert. Er ist geeignet, Clavesin 1 in Proben von Ratte, Maus und Human zu detektieren.

Kurzübersicht für Clavesin 1 Antikörper (N-Term) (ABIN631673)

Target: Clavesin 1 (CLVS1)

Reaktivität: Ratte, Maus, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Clavesin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Clavesin 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RLBP1 L1 antibody was raised against the N terminal of RLBP1 1

Aufreinigung: Affinity purified

Immunogen: RLBP1 L1 antibody was raised using the N terminal of RLBP1 1 corresponding to a region with amino acids NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RLBP1L1 Blocking Peptide, (ABIN5615877), is also available for use as a blocking control in assays to test for specificity of this RLBP1L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RLBP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Clavesin 1

Target: Clavesin 1 (CLVS1)

Andere Bezeichnung: RLBP1L1

Hintergrund: RLBP1L1 contains 1 CRAL-TRIO domain. It may be used as a marker for human hepatocellular carcinomas.

Molekulargewicht: 41 kDa (MW of target protein)