PCGF5 Antikörper (N-Term)

Produktnummer ABIN631667

Produktdetails anti-PCGF5 Antikörper

Target: PCGF5 (Polycomb Group Ring Finger 5 (PCGF5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCGF5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCGF5 antibody was raised against the N terminal of PCGF5

Aufreinigung: Affinity purified

Immunogen: PCGF5 antibody was raised using the N terminal of PCGF5 corresponding to a region with amino acids ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCGF5 Blocking Peptide, catalog no. 33R-1571, is also available for use as a blocking control in assays to test for specificity of this PCGF5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCGF5

Target: PCGF5 (Polycomb Group Ring Finger 5 (PCGF5))

Andere Bezeichnung: PCGF5 (PCGF5 Produkte)

Synonyme: RNF159 antikoerper, 0610009F02Rik antikoerper, 1110054A01Rik antikoerper, 5830406C17Rik antikoerper, 5830443C21Rik antikoerper, 9530023M17Rik antikoerper, AI324127 antikoerper, pcgf5 antikoerper, zgc:136815 antikoerper, zgc:194668 antikoerper, zgc:194700 antikoerper, polycomb group ring finger 5 antikoerper, polycomb group ring finger 5b antikoerper, polycomb group ring finger 5a antikoerper, PCGF5 antikoerper, Pcgf5 antikoerper, pcgf5b antikoerper, pcgf5a antikoerper

Hintergrund: PCGF5 contains 1 RING-type zinc finger. It is probable component of some Polycomb group (PcG) multiprotein complex, a complex required to maintain the transcriptionally repressive state of some genes.

Molekulargewicht: 30 kDa (MW of target protein)