UBE2L3 Antikörper (C-Term)

Produktnummer ABIN631658

Der Kaninchen Polyklonal Anti-UBE2L3-Antikörper wurde für WB validiert. Er ist geeignet, UBE2L3 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für UBE2L3 Antikörper (C-Term) (ABIN631658)

Target: UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2L3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBE2L3 Antikörper

Bindungsspezifität: C-Term

Spezifität: UBE2 L3 antibody was raised against the C terminal of UBE2 3

Aufreinigung: Affinity purified

Immunogen: UBE2 L3 antibody was raised using the C terminal of UBE2 3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2L3 Blocking Peptide, (ABIN939510), is also available for use as a blocking control in assays to test for specificity of this UBE2L3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2L3

Target: UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))

Andere Bezeichnung: UBE2L3

Hintergrund: UBE2L3(ubiquitin-conjugating enzyme E2L 3) Antibody The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s).

Molekulargewicht: 17 kDa (MW of target protein)