NKD1 Antikörper
-
- Target Alle NKD1 Antikörper anzeigen
- NKD1 (Naked Cuticle Homolog 1 (NKD1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NKD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- NKD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG
- Top Product
- Discover our top product NKD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NKD1 Blocking Peptide, catalog no. 33R-2577, is also available for use as a blocking control in assays to test for specificity of this NKD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NKD1 (Naked Cuticle Homolog 1 (NKD1))
- Andere Bezeichnung
- NKD1 (NKD1 Produkte)
- Synonyme
- 2810434J10Rik antikoerper, 9030215G15Rik antikoerper, Nkd antikoerper, Naked1 antikoerper, naked cuticle homolog 1 antikoerper, naked cuticle 1 homolog (Drosophila) antikoerper, naked cuticle homolog 1 (Drosophila) antikoerper, NKD1 antikoerper, Nkd1 antikoerper, nkd1 antikoerper
- Hintergrund
- In the mouse, NkDa is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.
- Molekulargewicht
- 52 kDa (MW of target protein)
-