NKD1 Antikörper

Produktnummer ABIN631653

Der Kaninchen Polyklonal anti-NKD1 Antikörper (ABIN631653) detektiert spezifisch NKD1 in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für NKD1 Antikörper (ABIN631653)

Target: NKD1 (Naked Cuticle Homolog 1 (NKD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NKD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-NKD1 Antikörper

Aufreinigung: Affinity purified

Immunogen: NKD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NKD1 Blocking Peptide, (ABIN937963), is also available for use as a blocking control in assays to test for specificity of this NKD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NKD1

Target: NKD1 (Naked Cuticle Homolog 1 (NKD1))

Andere Bezeichnung: NKD1

Hintergrund: In the mouse, NkDa is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.

Molekulargewicht: 52 kDa (MW of target protein)