Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

WD Repeat Domain 34 (WDR34) (C-Term) Antikörper Primary Antibody

WDR34 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN631651
$647.32
Zzgl. Versandkosten $45.00
50 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 9 bis 11 Werktagen
  • Target
    WD Repeat Domain 34 (WDR34)
    Bindungsspezifität
    C-Term
    • 8
    • 8
    • 8
    • 7
    • 4
    • 2
    • 1
    • 1
    • 1
    Reaktivität
    Human, Maus, Ratte
    • 25
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    Wirt
    Kaninchen
    • 23
    • 2
    Klonalität
    Polyklonal
    • 25
    Konjugat
    Unkonjugiert
    • 10
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    Applikation
    Western Blotting (WB)
    • 22
    • 19
    • 1
    • 1
    Spezifität
    WDR34 antibody was raised against the C terminal of WDR34
    Aufreinigung
    Affinity purified
    Immunogen
    WDR34 antibody was raised using the C terminal of WDR34 corresponding to a region with amino acids SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    WDR34 Blocking Peptide, catalog no. 33R-8605, is also available for use as a blocking control in assays to test for specificity of this WDR34 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR34 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    WD Repeat Domain 34 (WDR34)
    Andere Bezeichnung
    WDR34 (WDR34 Antibody Abstract)
    Synonyme
    wdr34, zgc:171284, DKFZp469F164, MGC89396, DIC5, bA216B9.3, 3200002I06Rik, WD repeat domain 34, WD repeat domain 34 L homeolog, wdr34, WDR34, wdr34.L, Wdr34
    Hintergrund
    WDR34 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
    Molekulargewicht
    58 kDa (MW of target protein)
Sie sind hier:
help Kundenservice