WDR34 Antikörper (C-Term)

Produktnummer ABIN631651

Produktdetails anti-WDR34 Antikörper

Target: WDR34 (WD Repeat Domain 34 (WDR34))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR34 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR34 antibody was raised against the C terminal of WDR34

Aufreinigung: Affinity purified

Immunogen: WDR34 antibody was raised using the C terminal of WDR34 corresponding to a region with amino acids SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR34 Blocking Peptide, catalog no. 33R-8605, is also available for use as a blocking control in assays to test for specificity of this WDR34 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR34 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR34

Target: WDR34 (WD Repeat Domain 34 (WDR34))

Andere Bezeichnung: WDR34 (WDR34 Produkte)

Hintergrund: WDR34 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Molekulargewicht: 58 kDa (MW of target protein)