PAOX Antikörper

Produktnummer ABIN631642

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PAOX in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für PAOX Antikörper (ABIN631642)

Target: PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAOX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PAOX Antikörper

Aufreinigung: Affinity purified

Immunogen: PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids GGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSQENQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAOX Blocking Peptide, (ABIN938683), is also available for use as a blocking control in assays to test for specificity of this PAOX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAOX antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAOX

Target: PAOX (Polyamine Oxidase (Exo-N4-Amino) (PAOX))

Andere Bezeichnung: PAOX

Hintergrund: PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.

Molekulargewicht: 56 kDa (MW of target protein)