MBOAT1 Antikörper (N-Term)

Produktnummer ABIN631638

Dieses Anti-MBOAT1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MBOAT1 in WB. Geeignet für Human.

Kurzübersicht für MBOAT1 Antikörper (N-Term) (ABIN631638)

Target: MBOAT1 (Membrane Bound O-Acyltransferase Domain Containing 1 (MBOAT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBOAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MBOAT1 Antikörper

Bindungsspezifität: N-Term

Spezifität: MBOAT1 antibody was raised against the N terminal of MBOAT1

Aufreinigung: Affinity purified

Immunogen: MBOAT1 antibody was raised using the N terminal of MBOAT1 corresponding to a region with amino acids AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MBOAT1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this MBOAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBOAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBOAT1

Target: MBOAT1 (Membrane Bound O-Acyltransferase Domain Containing 1 (MBOAT1))

Andere Bezeichnung: MBOAT1

Hintergrund: MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.

Molekulargewicht: 56 kDa (MW of target protein)