NUP50 Antikörper (C-Term)

Produktnummer ABIN631630

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch NUP50 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für NUP50 Antikörper (C-Term) (ABIN631630)

Target: NUP50 (Nucleoporin 50kDa (NUP50))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUP50 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NUP50 Antikörper

Bindungsspezifität: C-Term

Spezifität: NUP50 antibody was raised against the C terminal of NUP50

Aufreinigung: Affinity purified

Immunogen: NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUP50 Blocking Peptide, (ABIN5615087), is also available for use as a blocking control in assays to test for specificity of this NUP50 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUP50

Target: NUP50 (Nucleoporin 50kDa (NUP50))

Andere Bezeichnung: NUP50

Hintergrund: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Tube Formation